What is the median weekly earnings of workers in the occupations listed for
2010?

What Is The Median Weekly Earnings Of Workers In The Occupations Listed For2010?

Answers

Answer 1

Answer:

$971

Step-by-step explanation:

To find the median value, place the numbers in value order (from lowest to highest) then find the middle:

So putting the weekly earnings for 2010 in value order:

501, 900, 971,  977, 1071

So the middle value is 971.  Therefore, the median = $971


Related Questions

I need help with this!! every time i use the formula i’m always one off

I need help with this!! every time i use the formula im always one off

Answers

By using the secant line formula, the average rate of change of function f(x) on the interval [3, 11] is equal to 4.

How to determine the average rate of change of a function

In accordance with the statement, we must determine the average rate of change for a given closed interval of the function f(x). Graphically speaking, the average rate of change for this interval is represented by the slope of the secant line passing through the two limits of the interval [a, b], which is found by secant line formula:

m = [f(b) - f(a)] / (b - a)

If we know that a = 3, f(a) = 19, b = 11 and f(b) = 51, then the average rate of change is:

m = (51 - 19) / (11 - 3)

m = 32 / 8

m = 4

To learn more on average rates of change: https://brainly.com/question/23715190

#SPJ1

father of economics

Answers

I’m going to assume you meant who is the father of economics

Answer: Adam Smith

4 X 4=16
4 X 5=20

What percent increase?

Answers

Step-by-step explanation:

20-16/16 x100

4/16 X 100 = 25%

HELP ME PLEASE FIRST PERSON TO GET IN RIGHT GETS BRAINLIEST.
Create and solve a multiplication problem to show that the product of a whole number and a fraction will be equal to the whole number.

Answers

Answer:

\( \frac{1}{2} \times 6 = 3 \\ \)

Yep

Answer:

(10)(3/5)=6

The parentheses is multiplication

Step-by-step explanation:

Solve for u. -5u/8=-10​

Answers

Answer:

u  16

Step-by-step explanation:

Divide Using Synthetic Division

Divide Using Synthetic Division

Answers

The result of the synthetic division is the final row. In this case, the result is -3, 5, -15, 18.

What is polynomial?

A polynomial is an expression consisting of variable and coefficient and are used to model real world situation it is an equation of degree greater than one where the exponents of the variables can be any non-negative integer for example the polynomial equation x 2 + 3x + 2 represent a parable of windcraft polynomial are used in name variety of field such as mathematics and physics.

The process of synthetic division is used to divide polynomials of the form ax^n + bx^n-1 + ... + c, where a is the coefficient of the highest power of the variable x.

To divide -3 into the polynomial 1 8 9 -18 0, the following steps should be taken:

Step 1: Line up the divisor, -3, to the left of the polynomial, as shown below:

-3 | 1 8 9 -18 0

Step 2: Bring down the first coefficient in the polynomial, which is 1, and place it directly below the -3.

-3 | 1 8 9 -18 0
  -3

Step 3: Multiply the -3 by the first coefficient and place the result in the next row, directly below the 8.

-3 | 1 8 9 -18 0
  -3
 -3

Step 4: Add the result to the 8, and place the new result in the next row.

-3 | 1 8 9 -18 0
  -3
 -3
  5

Step 5: Repeat steps 3 and 4 for each coefficient in the polynomial.

-3 | 1 8 9 -18 0
  -3
 -3
  5
 -15
-15
 18

Step 6: The result of the synthetic division is the final row. In this case, the result is -3, 5, -15, 18.
To know more about polynomial click-
https://brainly.com/question/24662212
#SPJ1


Complete questions as follows-
Divide Using Synthetic Division
-3|1 8 9 -18 0

Q(d) = 300 – P
Q(s) = 2P
What is equilibrium price and quantity?

Answers

The equilibrium price is $100. The equilibrium quantity is 200.

To find the equilibrium price and quantity, we need to set the quantity demanded (Qd) equal to the quantity supplied (Qs) and solve for the price (P).

Setting Qd = Qs, we get:

300 - P = 2P

Simplifying this equation, we get:

300 = 3P

P = 100

To find the equilibrium quantity, we can substitute the equilibrium price (P = 100) into either the demand or supply equation. Using the supply equation Qs = 2P, we get:

Qs = 2P = 2(100) = 200

In summary, the equilibrium price and quantity for this market are respectively $100 and 200 units. At this price, the quantity demanded and supplied are equal, leading to market stability. This information is important for producers and consumers to understand the current state of the market and how it can impact their behaviour and decisions.

For such more questions on equilibrium

https://brainly.com/question/28945352

#SPJ8

Carter's trampoline has a diameter of 10 ft. Its circumference is twice as great as the circumference of Reed's trampoline. What is the circumference of Reed's trampoline.​

Answers

Answer:

no

Step-by-step explanation:

nsjdjfhfjskskdknxiwiwfbrbbewiisaksndbbfeueiaooand

How long will it take you to ski a distance of 36 miles at a speed of 3 miles per 30 minutes.

Answers

Answer:

6 hours

Step-by-step explanation:

Since there are 60 minutes in one hour, you can ski 3 * 2 = 6 miles per hour. Therefore, it will take you 36 / 6 = 6 hours to ski that distance.

Does this data appear to be proportional? Explain why or why not. (ANSWER ASAP!!!!!)

Does this data appear to be proportional? Explain why or why not. (ANSWER ASAP!!!!!)

Answers

Yes, the data contained in the table above is proportional because both quantity x and quantity y all have the same constant of proportionality.

What is a direct proportion?

Mathematically, a direct proportion or direct variation can be represented the following mathematical expression:

y = kx

Where:

y and x are the variables or dimensions.k represents the constant of proportionality.

For the data contained in the table above to be proportional, both quantity x and quantity y must remain in a constant ratio.

Next, we would determine the constant of proportionality (k) as follows:

Constant of proportionality (k) = y/x

Constant of proportionality (k) = 6.3/2

Constant of proportionality (k) = 3.15

For row 2, we have:

Constant of proportionality (k) = 18.9/6

Constant of proportionality (k) = 3.15

For row 3, we have:

Constant of proportionality (k) = 28.35/9

Constant of proportionality (k) = 3.15

For row 4, we have:

Constant of proportionality (k) = 15.75/5

Constant of proportionality (k) = 3.15

For row 5, we have:

Constant of proportionality (k) = 3.15/1

Constant of proportionality (k) = 3.15

Read more on proportionality here: brainly.com/question/12866878

#SPJ1

. If two of the angles in a scalene triangle are 54° and 87°, what is the other angle?

Answers

39 because 54+87=141 and now u have to subtract 141 from 180 so it gives u 39

The answer is:

⇨ x = 39°

Work/explanation:

Bear in mind that the sum of all the angles in a triangle is 180°.

Given two angles, we can easily find the third one.

Let's call it x.

Next, we set up an equation:

\(\sf{54+87+x=180}\)

\(\sf{141+x=180}\)

Subtract 141 on each side.

\(\sf{x=180-141}\)

\(\sf{x=39}\)

Hence, the other angle is 39°.

Factor 4z² + 4z – 3.​

Answers

Answer:

4z²+6z-2z-3

=2z(2z+3)-(2z+3)

=(2z+3)(2z-1)

Answer:

(2z-1) (2z+3)

Step-by-step explanation:

4z² + 4z – 3.

=> Factor out 2z from 4z²-2z:

  -> 2z(2z-1)

=>Factor out 3z from 6z-3:

  -> 3(2z-1)  

-> 2z(2z-1)+3(2z-1)

=> Factor out common term 2z-1

   -> (2z-1) (2z+3)

What is the instantaneous rate of change y=sqrtx of at x = 2? Responses negative 1 over 2 negative 1 over 4 negative 1 none of these none of these

Answers

The instantaneous rate of change of y = √x at x = 2 is √2 / 2.

To find the instantaneous rate of change of y = √x at x = 2, we need to calculate the derivative of the function with respect to x and evaluate it at x = 2.

Taking the derivative of y = √x using the power rule for differentiation, we have:

dy/dx = (1/2) × x^(-1/2)

Now, substituting x = 2 into the derivative expression:

dy/dx = (1/2) × 2^(-1/2)

= (1/2) × √2

= √2 / 2

Therefore, the instantaneous rate of change of y = √x at x = 2 is √2 / 2.

None of the provided options (-1/2, -1/4, -1) are the correct instantaneous rate of change at x = 2.

for such more question on instantaneous rate

https://brainly.com/question/23377525

#SPJ8

Complete both transformations below. Then enter the final coordinates of the figure.

A (-4,0)

B

A" ([?], []) C" ([], [])

C (-3,-3)

1) Reflect across y-axis 2) < -5,2>​

Complete both transformations below. Then enter the final coordinates of the figure.A (-4,0)BA" ([?],

Answers

Answer:

A"(-1, 2)B"(-5, 1)C"(-2, -1)

Step-by-step explanation:

You want points A(-4, 0), B(0, -1) and C(-3, -3) reflected across the y-axis and translated left 5 and up 2.

Transformation

The reflection across the y-axis changes the sign of the x-coordinate:

  (x, y) ⇒ (-x, y)

The translation adds the translation vector to the reflected coordinates.

  (x, y) ⇒ (x -5, y +2) . . . . . . translation (by itself)

Then the result of both transformations is ...

  (x, y) ⇒ (-x -5, y +2)

For a number of points, this arithmetic is conveniently accomplished by a calculator. The result is ...

A"(-1, 2)B"(-5, 1)C"(-2, -1)
Complete both transformations below. Then enter the final coordinates of the figure.A (-4,0)BA" ([?],

Given g(x)=5x+2, find g(-6)

Answers

Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj

Answer:

Please refer to the attachment

Hope it helps

Please mark me as the brainliest

Thank you

Given g(x)=5x+2, find g(-6)

PLEASE HELP! I really need to get this right

PLEASE HELP! I really need to get this right

Answers

Answer:

27.3

Step-by-step explanation:

27.3

Answer:

Plays a musical instrument

Top left

Plays a sport: 0.46

Plays a musical instrument

Top right

Does not Play a sport: 0.54

Does not play a musical instrument

Bottom Left

Plays a sport: 0.73

Does not play a musical instrument

Bottom right

Does not Play a sport: 0.27

Step-by-step explanation:

I hope this helps you! :D

Which of the following expressions is equal to -3x2 - 12?

Which of the following expressions is equal to -3x2 - 12?

Answers

Answer:

C. (-3x+6)(x+2)

Step-by-step explanation:

that should help you

The equation of line g is y = -6/7x + 3 line h is parallel to line g what is the slope of line h

Answers

Answer:

It should be -6/7 because parallel lines have the same slope

Solve 7 + x - 15 = -2 2/3

Answers

Answer: i am 99.9% sure the answer is 16/3 or the other forms of it 5.3 repeating three or mixed number 5 1/3

how many eggs are in a half dozen​

Answers

Answer:

6

Step-by-step explanation:

We know that a dozen is the value of 12 so to find half a dozen we simply need to half it!

12 ÷ 2 = 6

This means that there are 6 eggs in a half dozen.

FUN FACT:

A baker's dozen is 13, one more than a regular dozen!

Hope this helps, have a lovely day!

Which sequence of transformations was applied to the parent tangent function to create the function m(x) = 2tan(3x+4)

Answers

The function m(x) = 2tan(3x+4) is obtained by applying a sequence of transformations to the parent tangent function.

To determine the sequence of transformations, let's break down the given function:

1. Inside the tangent function, we have the expression (3x+4). This represents a horizontal compression and translation.

2. The coefficient 3 in front of x causes the function to compress horizontally by a factor of 1/3. This means that the period of the function is shortened to one-third of the parent tangent function's period.

3. The constant term 4 inside the parentheses shifts the function horizontally to the left by 4 units. So, the graph of the function is shifted to the left by 4 units.

4. Outside the tangent function, we have the coefficient 2. This represents a vertical stretch.

5. The coefficient 2 multiplies the output of the tangent function by 2, resulting in a vertical stretch. This means that the graph of the function is stretched vertically by a factor of 2.

In summary, the sequence of transformations applied to the parent tangent function to create the function m(x) = 2tan(3x+4) is a horizontal compression by a factor of 1/3, a horizontal shift to the left by 4 units, and a vertical stretch by a factor of 2.

Example:
Let's consider a point on the parent tangent function, such as (0,0), which lies on the x-axis.

After applying the transformations, the corresponding point on the function m(x) = 2tan(3x+4) would be:
(0,0) -> (0,0) (since there is no vertical shift in this case)

This example helps illustrate the effect of the transformations on the graph of the function.

For more question on expression

https://brainly.com/question/1859113

#SPJ8

What is 12 times the square root of 16?

Answers

The answer to this is 48

Will give brainliest and thanks and please explain

Will give brainliest and thanks and please explain

Answers

Answer:

(65-5) / 2.5 = d

Step-by-step explanation:

100% sure

Answer:

d=65/2-5

26days

Step-by-step explanation:

The temperature fell from 0 Degrees Fahrenheit to 15 and one-half Degrees Fahrenheit below 0 in 5 and three-fourths hours. Wen tried to find the change in temperature per hour. Her work is shown below. Negative 15 and one-half divided by 5 and three-fourths = negative StartFraction 31 over 2 EndFraction divided by StartFraction 23 over 4 EndFraction = negative StartFraction 31 over 2 EndFraction times StartFraction 23 over 4 EndFraction = Negative StartFraction 713 over 8 EndFraction

Answers

Answer:

The correct answer will be:

\(-\dfrac{62}{23}\)

Step-by-step explanation:

It is given that :

Initial temperature, \(T_1 = 0^\circ F\)

Final temperature,

\(T_2 = -15\dfrac{1}{2}^\circ F\\\Rightarrow T_2 = -\dfrac{15\times 2+1}{2} ^\circ F\\\Rightarrow T_2 = -\dfrac{31}{2} ^\circ F\)

Time taken :

\(5\dfrac{3}{4}\ hrs = \dfrac{5 \times 4+3}{4}\ hrs = \dfrac{23}{4}\ hrs\)

Change in temperature per hour:

\(\dfrac{\text{Difference of temperature}}{\text{Total Time Taken}}\\\Rightarrow \dfrac{T_2-T_1}{\text{Total Time Taken}}\)

Putting the values of temperatures and time:

\(\dfrac{\dfrac{-31}{2}-0}{\dfrac{23}{4}}\\\Rightarrow \dfrac{\dfrac{-31}{2}}{\dfrac{23}{4}}\\\Rightarrow \dfrac{-31 \times 4}{2 \times 23}} \text{---- Error done by Wen at this step}\\\Rightarrow \dfrac{-31 \times 2}{23}}\\\Rightarrow \dfrac{-62}{23}}\)

The error done by Wen was during calculating the values of fraction.

So, the correct answer is :\(\frac{-62}{23}}\) instead of \(\frac{-713}{8}\)

Answer:

C. Wen did not take the reciprocal of the divisor

Step-by-step explanation:

What does 10.98+4.06

Answers

Answer:

15.01

Step-by-step explanation:

10.95+4.06

Answer:

15.01

Hope that helps :-)

Red city rockets connections academy

Answers

Answer: what

Step-by-step explanation:

A repair person charges a travel fee to visit a home and an hourly fee for the time spent fixing a leak.
A repair that takes 2 h costs $100. A repair that takes 6 h costs $260.
■ Write an equation to represent the total cost of a repair, y, as a function of the
number of hours spent fixing a leak, z.
+,-,•,=,20,40,x,y

Answers

The total cost of a repair is a linear function of the number of hours spent fixing a leak is y = $20 + ($40/hour)x.

What is linear equation?

Linear equations can be used to represent relationships between two variables that are directly proportional, such as distance and time or cost and quantity. They are also useful in graphing straight lines and making predictions based on patterns and trends.

According to question:

Let "t" be the travel fee charged by the repair.

Let "h" be the hourly fee charged by the repair.

Based on the information given, we know that:

When x = 2, y = $100.

When x = 6, y = $260.

We can use these two points to find the values of "t" and "h" and write an equation to represent the total cost of a repair as a function of the amount of time required to remedy a leak.

First, we can find the value of "h" by using the slope formula:

(h) = (change in y) / (change in x) = ($260 - $100) / (6 - 2) = $40/hour

Next, we can use one of the points (2, $100) to find the value of "t":

$100 = (2 hours)($40/hour) + t

t = $20

Therefore, the equation that represents the total cost of a repair as a function of the number of hours spent fixing a leak is:

y = th + hx

Substituting the values of "t" and "h" that we found, the equation becomes:

y = $20 + ($40/hour)x

So, the total cost of a repair is a linear function of the number of hours spent fixing a leak.

To know more about linear equation visit:

https://brainly.com/question/11897796

#SPJ1

The complete question is A repair charges a travel free to vist a home and an hourly fee for the time spent fixing a leak. A repair that takes 2 h costs a $100. A repair that takes 6 h costs $260

Write an equation to represent the total cost of a repair, y, as a function of the number of hours spent fixing a leak, x.

Look at the number line below.




Which expression represents the distance between T and U on the number line?

*please I need help!*

A). |-2+ -5|
B). |-2 - -5|
C). -5 - -2
D). |-2|+|-5|

Look at the number line below. Which expression represents the distance between T and U on the number

Answers

B. is the ans hope you get a hundred

How many solutions does the following function have? 2x^2-3x+1=0

Answers

The given expression is

\(2x^2-3x+1=0\)

Let's use the discriminant to know the number of solutions.

\(b^2-4ac\)

Where a = 2, b = -3, and c = 1.

\((-3)^2-4\cdot2\cdot1=9-8=1\)This means the equation has two real solutions.

Given four numbers P, Q, R and S. The first three numbers form an arithmetic sequence while the last three form a geometric sequence. If the sum of the first and the fourth number is 16 and the sum of the second and the third number is 12, find these four numbers.

Answers

The most appropriate choice for arithmetic and geometric series will be given by-

P = 0, Q = 4 , R = 8, S = 16 or P = 15, Q = 9, R = 3, S = 1 are the required numbers

What is arithmetic and geometric series?

Arithmetic series are those series whose difference between two consecutive terms are same.

Geometric series are those series whose ratio between two consecutive terms are same.

Here,

P, Q and R forms an Arithmetic sequence

Let P = a - d , Q = a, R = a + d, Where a is the first term of the Arithmetic sequence and d is the common difference of the sequence.

Let S = b

Q, R and S forms a Geometric sequence

\(\frac{a + d}{a} = \frac{b}{a +d}\)

\((a + d)^2 = ab\\a^2 + d^2 + 2ad = ab\\\) ............... (1)

Now the sum of first and fourth number is 16

a - d + b = 16

b = 16 - a + d

Putting the value of b in (1),

\(a^2 + d^2 + 2ad = a(16 - a +d)\\a^2 + d^2 + 2ad = 16a -a^2+ad\\a^2+a^2 + d^2+2ad - ad - 16a = 0\\2a^2 + ad+d^2 -16a = 0\)............ (2)

Sum of second and third number is 12

\(a + a + d = 12\\2a +d = 12\\d = 12-2a\)

Putting the value of d in (2)

\(2a^2 + a(12 - 2a)+(12 - 2a)^2-16a = 0\\2a^2 + 12a - 2a^2+144-48a+4a^2 - 16a = 0\\4a^2-52a+144=0\\4(a^2-13a+36)=0\\a^2 -13a+36=0\\a^2-9a-4a+36=0\\a(a - 9)-4(a-9)=0\\(a-4)(a-9) = 0\\\)

\(a - 4 = 0\) or \(a - 9 = 0\)

\(a = 4\) or \(a = 9\)

When a = 4,

\(d = 12 - 2\times 4\\d = 12 - 8\\d = 4\)

\(b = 16 - 4+4\\b = 16\)

P = 4 - 4 = 0

Q = 4

R = 4 + 4 = 8

S = 16

When a = 9,

\(d = 12 - 2\times 9\\d = 12 - 16\\d = -6\)

\(b = 16 - 9-6\\b = 1\)

P = 9 - (-6) = 15

Q = 9

R = 9 + (-6) = 3

S = 1

To learn more about arithmetic and geometric series, refer to the link:

https://brainly.com/question/24643676

#SPJ9

Other Questions
solve equation x-17=18 what is the answer A hiker sees a lightning flash; 18 s later he hears the sound of the thunder. Recalling from his study of physics that the speed of sound in air is approximately (1/3) km/s. Calculate the distance of lightning flash. [ Assume that speed of sound is negligible as compared to speed of light] (7 pts) Karissa made a giant circular sugar cookie for dessert. she wants to frost it. the cookie has a 14 inch diameter. how many square inches of frosting are needed to cover the entire top of the cookie? hint-it's either area or circumference. use 3.14 for pi If three points A, B, and Care plotted so that no two of the taxicab distances AB,BC, and AC* are equal, the points are said to form a taxi-scalene triangle. Sketch a taxi-scalene triangle that is isosceles in Euclidean geometry and fill in both the taxicab distances and the Euclidean distances below. AB* = AB = BC* = BC =AC* = AC = Knowing the importance of the Essential Elements, why would someone chose a diet that does not address all of them? You answer 21 out of 25 questions correctly on a test. Did you reach your goal of getting 80% or better? sonya makes a pattern of values for x and a pattern for y, which ordered pair continues the patterns and has an x-value of 6 Part A which sentence from section 3 is the best example of pathos or an emotional appeal? Determine if the statement is true or false. All defendants in criminal trials are granted the right to a presumption of innocence Site 1: Brief History of The Trail of Tears What was the path and means of transportation of the last group of Cherokee to be moved west? technician a says that a missing wire harness grommet may cause wind noise. technician b says that dealer installed bug shields will not affect airflow around a vehicle. who is right? most of the craters on both mercury and the moon formed ________. Cecilias math textbook is 786 pages. What is the total number of pages in 19 of these textbooks?Enter your answer in the box. meg is considering a move to a foreign country and wants to deed her property to her son, christian, whos 16. which of these must occur to make this transfer legal? is an international organization of nation-states that seeks to promote peace, international relations, and economic and environmental programs The Louisiana Purchase was controversial because .... However, it was the foundation for the westward expansion of the United States. The purchase doubled the size of the country and ensured ... Tabcorp provides wagering products via internet, mobile devices and phone?TrueFalse need help asap if someone can help i will be so happy In a few sentences, describe where the power lies in a democracy. Which of the following foods was introduced into Mexico by Spanish explorers?a. Tomatoesb. Ricec. Squashd. Corn