The slope of a function represents its rate of change. In the given scenario, we have the function f(x) = 4x + 10 with a slope of 4.
To compare the slopes of f(x) and g(x), we need the equation or slope of g(x). Without that information, it is not possible to determine which function has a greater slope.
The slope of a linear function is represented by the coefficient of the x term. In the case of f(x) = 4x + 10, the slope is 4. However, without the equation for g(x), we cannot compare the slopes. If you can provide the equation or additional information about g(x), I can assist you in determining which function has a greater slope.
Learn more about greater slope here:
https://brainly.com/question/31090154
#SPJ11
Consider the following figure ABDC with diagonal BC. Sides AB and DC are congruent angle A is congruent to angle D and sides AC and DB are congruent
Quadrilateral ABCD is both a parallelogram and a rhombus.
The figure ABDC with diagonal BC, with the congruent sides AB and DC, angle A is congruent to angle D, and sides AC and DB are congruent is a parallelogram. This is based on the definition of a parallelogram which is a quadrilateral with opposite sides that are parallel and congruent to each other.
Also, opposite angles of a parallelogram are congruent. Therefore, angle A and angle C are congruent. Additionally, angle B and angle D are also congruent because they are opposite angles of a parallelogram.The diagonal of a parallelogram cuts it into two congruent triangles.
Triangle ABD and triangle CBD are congruent triangles, since their sides are congruent, and angles A and D, and angles B and C, are congruent by the given information.
Therefore, their included angles ABD and CBD are also congruent. Because their opposite sides are congruent, quadrilateral ABCD is a rhombus. A rhombus is a parallelogram with all sides congruent. This implies that sides AB, BC, CD, and DA are all equal.
In conclusion, quadrilateral ABCD is both a parallelogram and a rhombus.
For more such questions on parallelogram, click on:
https://brainly.com/question/3050890
#SPJ8
If the sun got bigger in size how may this affect food sources
Answer:
When sun gets big the surrounding planets like Mars, venus, and earth got to be destroy
What resources do consumers typically have in limited supply that forces.
Answer:
Supply and Demand (Prices/Auction): This allocation strategy allows rationing of a resource based on who can afford the price set by the market. The more desirable and relatively scarce the item, generally, the higher the price. This method is efficient because one can easily tell whether or not the resource can be allocated based on their willingness and ability to pay the price. However, this method will exclude people from markets if they lack the money to pay the price. • Authority: This allocation strategy allows for quick action because a person or a group of people in power can make and implement the decision quickly. In countries where the government makes and carries out decisions by force, economic changes can happen quickly because the government decides how to distribute resources and enforces the decision through military/police power. • Random Selection (Lottery): This allocation strategy can be handled quickly and gives everyone who wants the resource equal odds of receiving it. This strategy can be inefficient because it may allocate the resource to a purpose or person who does not need it or know how to produce using it. If the government randomly selects individuals to receive farmland, the land may go to someone who has no knowledge of farming techniques and the resource maybe underutilized. • First Come, First Served: This allocation strategy allows people to receive a resource if they are the first one in line for it. Many concert and sporting events use this method in addition to price. Rather than set all prices extremely high because there are people willing to pay it, many events offer lower price tickets so that all fans will have a chance of purchasing an affordable ticket. This can be an inefficient strategy because fans will spend time they could have used at work or school to camp out at the ticket window or endlessly refresh their online browser as the ticket outlet's servers are overwhelmed. • Personal Characteristic: This allocation strategy allows resources to be distributed based on need or merit. Ideally, the person who gets the scholarship or the job is the one best qualified for it. However, personal characteristics can also be used negatively such as when one does not get a job due to discrimination against a personal characteristic of the individual. • Contest: This allocation strategy can distribute the resource to the person who wins. The "winning" could be based on running a race (who is fastest), in academics (valedictorian has the highest GPA), or in a test of knowledge/skill (Jeopardy contestant or chess champion). This strategy can be inefficient on a day to day basis. You don't want to run a race to see who gets the last slice of pizza in the cafeteria. It would take too long.
Explanation:
Determine the value of x in the figure.
Question 11 options:
A)
x = 40
B)
x = 135
C)
x = 90
D)
x = 45
x is 45
the angle right above 135 is the same as x, and the angle above 135 is 45
Hallo. Come be weird with meeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeedon’t you dare answer if your not weird:( kalakakumba out
Answer:
kumbaya
Explanation:
book nerd that is who i ammmmm looooooooooollll
i <3 books (or do i??)
6
Which of the following is equivalent to 2x(x2 – 3x) ?
Answer:
2x²-6x²
Explanation:
1356036189+123342345
Answer:
1479378534
Explanation:
i added
what is hypotinuse to the upunnette square
The hypotenuse of a right triangle is related to the other two sides (the adjacent and opposite sides) by the Pythagorean theorem, which states that the square of the hypotenuse is equal to the sum of the squares of the other two sides.
What is hypotenuse?The hypotenuse is the longest side of a right triangle, which is the triangle that has one angle that measures 90 degrees (a right angle). The other two sides that form the right angle are called the adjacent and opposite sides. The adjacent side is the side that forms the angle with the hypotenuse, while the opposite side is the side that is opposite to the angle formed with the hypotenuse.
Therefore, if the length of the adjacent side is a and the length of the opposite side is b, then the length of the hypotenuse is given by the square root of (a² + b²). This formula is applicable to any right triangle, regardless of the size or shape of its sides.
Learn more about hypotenuse from
https://brainly.com/question/30513523
#SPJ1
John bought 15 pines for $3500
determine how much he needs to sell
one pine for to ensure an overall 40%
profit
Answer:
Explanation:
If John needs to ensure a 40% profit, John needs to sell the pines at a price that would give 40% more money back than he spent.
Since John needs to make back all of the money he spent, plus another 40%, John needs to get back 140% of what he spent.
\(140\% = 1.40\)
John spent $3500.
140% of $3500 is $4900.
So, John must bring in $4900 (revenue) selling all 15 pines to achieve a 40% profit.
However, the question asks for the price of a single pine. To find the unit price of a single pine, divide the total revenue by 15.
\(\frac{\$4900}{15pines}=\frac{\$326.\bar{6}}{pine}=\$326.66 \text{ per pine}\)
This year, a company consumed 30 percent
fewer sheets of paper than it did last year. If the
company used 270,000 sheets of paper this year,
approximately how many sheets did it use last
year?
A) 351,000
B) 362,000
C) 378,000
D) 386,000
Answer:
Explanation:
Sheet used this year = 270,000
Sheet used last year = 270,000 + 270,000*30% = 270,000 + 81,000 = 351,000
04.02 Comparing Functions
i need help asap yall
Answer:
1. -10
2. -1
3. -3
How does the conflict "character versus nature" tie into the theme of the story? The Grasshopper and The Ant
The conflict of character versus nature is an external conflict in literature. It is frequently represented as a person battling the environment, including natural disasters, wild animals, or the natural world's destructive side.
In The Grasshopper and The Ant, this conflict ties into the story's theme in a variety of ways.
To begin with, the narrative depicts how nature, in this case, the environment, can have an impact on our lives. Throughout the story, the grasshopper avoids the ant's attempts to prepare for the winter, preferring to sing and dance.
When the winter arrives, the grasshopper is caught unprepared and ends up hungry and freezing. The story's moral teaches readers that being ill-prepared can be disastrous, especially when it comes to nature. It also highlights the importance of being proactive in preparing for the worst.
Another way the character versus nature conflict ties into the story's theme is by highlighting the ant's perseverance and hard work. Despite the harsh circumstances, the ant remains determined and dedicated to his goal of preparing for the winter. This serves as an inspiration to readers to persevere even in the most challenging situations.
Furthermore, the story shows how nature can be both harsh and benevolent. The grasshopper suffers due to the harsh winter, but the ant's hard work also pays off in the end when he can enjoy the fruits of his labor. This teaches readers that nature can both give and take away.
Finally, the conflict of character versus nature in The Grasshopper and The Ant serves to teach readers about the importance of balance. The ant's hard work and preparation are admirable, but the grasshopper's love of life and music is also crucial. This emphasizes that while it's essential to be prepared, it's also necessary to enjoy life and not take it for granted.
For more such questions on conflict, click on:
https://brainly.com/question/26202241
#SPJ8
What are the economic pros and cons of Gambling in Nebraska?
Why can Dry food such as instant noodles, biscuits and potato chips be stored for a long time
Answer:
Dry foods such as instant noodles, biscuits and potato chips can be stored for a long time because they contain very little moisture. Moisture is what causes food to spoil quickly. Dry foods that contain less than 10 percent of moisture are the perfect candidates for long-term storage. Anything higher than ten could be difficult. 13% is a crucial number, with any foods higher than that posing too high of risk towards bacteria, mold, and fungus growth.
To store dry food properly, it should be kept in a cool and dry place. The storage temperature helps determine the length of storage; the higher the temperature, the shorter the storage time. Dried foods are susceptible to insect contamination and moisture reabsorption and must be properly packaged and stored immediately.
Explanation:
Hope this helps
Answer:
well exposing this things to air can make them spoil meaning they put preservatives in the packet of the biscuits the preservatives arent perment so they could spoil in the case,while exposing them to air can make them soft leading to spoilage
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
20ax - x= 5 in the equation above, a is a constant if the equation has no solution, what is the value of a ?
The Framers of the Constitution gave specific powers to both the nation as well as individual states. Explain why printing currency is a delegated power. What problems would arise if each state was able to print their own money?
Answer:
Printing currency is a delegated power assigned to the federal government under the Constitution. The Framers recognized the importance of a uniform national currency to facilitate commerce, promote economic stability, and prevent inflation. Allowing states to print their own money could cause confusion, inflation, and fraud, and undermine the stability of the national economy. Hence, the power of currency printing is delegated to the federal government to maintain uniformity and stability in the economy.
27 9. During the collision, both marbles accelerate to a stop, or to a velocity of O m/s. Use the formula Vinai – Vinitia, to calculate the change in velocities for the orange and blue marbles. Orange marble: 0 m/s-(-2 m/s) = 2 m/s Blue marble: 0 m/s - 2 m/s =
Answer:
Yabure kabure no yabu isha ga take yabu
no naka e sutta kora sa yabu karabōni sutta kora sa
yaburetaraburetāmotte sutta kora sa
Explanation:
20
Intersecting lines r, s, and t are shown below.
106°
239
What is the value of a?
I
Answer:
97°
Explanation:
Taking line s;
Inner angle ;st
st + 106 = 180° (Sum of angles on a straight line)
st = 180 - 106 = 74°
Third angle in the inner triangle, take angle as a:
74 + 23 + a = 180 (sum of angles in a triangle)
97 - a = 180°
a = 180 - 97
a = 83°
a + x = 180 (Sum of angles on a straight line)
83 + x = 180
x = 180 - 83
x = 97°
The value of x is 97°.
Intersecting LinesTaking line s; Inner angle ;
st
st + 106 = 180° (Sum of angles on a straight line)
st = 180 - 106
st = 74°
Third angle in the inner triangle, take angle as b:
74 + 23 + a = 180 (sum of angles in a triangle)
97 - b = 180°
b = 180 - 97
b = 83°
b + x = 180 (Sum of angles on a straight line)
83 + x = 180
x = 180 - 83
x = 97°.
Learn more about "Triangle":
https://brainly.com/question/25813512?referrer=searchResults
how can i tell if a virgo dude is playing me pls use it as simple words
Answer:
People on Brainly cannot answer this for you, sorry
Explanation:
First, an electrically charged object is brought near an uncharged object. Then, the electrically charged object is brought near another electrically charged object.
In which of these situations would it be reasonable to expect the object to be either attracted or repelled?
Group of answer choices
Not in either situation
Only in the first situation
Only in the second situation
In both situations
Explanation:
I want to say only in the second situation but I could be wrong.
What are five things you want to convey about yourself in your personal statement?
Be specific and this is about college.
Answer:
Here are five things that a typical student might want to convey in their college personal statement:
Passion and motivation: Show the reader why you are passionate about pursuing higher education and what motivates you to succeed in your chosen field of study.Unique background and experiences: Highlight experiences that have shaped your personal and academic journey, and what sets you apart from other applicants.Strong academic track record: Discuss your academic achievements, such as grades, test scores, and relevant coursework, to demonstrate your academic potential and commitment to success.Relevant skills and interests: Discuss any relevant skills, extracurricular activities, and interests that have prepared you for college and have relevance to your intended field of study.Goals and aspirations: Discuss your future goals and aspirations, and how earning a college degree will help you achieve them. Explain how the college you are applying to fits with your plans and how you plan to contribute to the college community.Should banks have to hold 100% of their deposits? Why or why not?
HELP ASAP PLEASE
Answer:
100 percent for the charge
How old was the inaugural poet?
Answer:
22
Explanation:
she was
The University of Florida Honors Program is a "community of scholars" bound together
by a shared interest in maximizing the undergraduate experience. Why are you drawn to
this type of community at UF, and how do you plan to contribute to it in and out of the
classroom?
How does the narrator’s viewpoint compare to the turtle’s in this passage? the narrator and the turtle both agree that jim talks too much. the narrator and the turtle both wish that jim would learn to play the fiddle. the narrator and the turtle both love to play the fiddle for the plantation owner. the narrator and the turtle both dislike jim.
Answer:
The answer is A. The narrator and the turtle both agree that Jim talks too much.
Explanation:
Answer: How does the narrator’s viewpoint compare to the turtle’s in this passage?
The narrator and the turtle both agree that Jim talks too much.
The narrator and the turtle both wish that Jim would learn to play the fiddle.
The narrator and the turtle both love to play the fiddle for the plantation owner.
The narrator and the turtle both dislike Jim.
Explanation: its A because it said in story
These questions are so hard to answer. Please help!
Answer:
i think B
Explanation:
what is arianators??
Answer:
it's a noun means a fan of American singer songwriter and actress Ariana Grand
Explanation:
People that like Ariana Grande i guess
A CLOSER LOOK AT Compound Inequalities We previously learned that compound inequalities are two inequalities joined by the word "or" or "and". Sometimes you really need to think about what the inequalities are saying before you determine the solution. Example at the Zoo: A sign at the ticket booth reads "Guests that are under 3 years old and over 62 years old get free admission!" Does this make sense? If not, why? How would you change it? Explain.
Compound inequality involves the combination of multiple inequalities. The sign at the ticket booth does not make sense. It should be written as:
"Guests that are under 3 years old or over 62 years old get free admission!"
The given statement can be split to two:
Condition 1: Guests that are under 3 years old.Condition 2: Guests that are over 62 years oldWhen the "and" clause is used in an inequality, it means that both conditions must be true.
But; conditions 1 and 2 are disjoint; i.e. they cannot happen at the same time.
In other words, you cannot be under 3 years old, and be over 62 years old at the same time.
So, we can conclude that this statement does not make sense.
The correction will be to replace the "and" clause with an "or" clause.
So, the new text will be:
"Guests that are under 3 years old or over 62 years old get free admission!"
Read more about compound inequalities at:
https://brainly.com/question/13290962
A pentagon $abcde$ is translated north by 40 units to pentagon $a_1 b_1 c_1 d_1 e_1. $ pentagon $a_1 b_1 c_1 d_1 e_1$ is then translated east by 50 units to pentagon $a_2 b_2 c_2 d_2 e_2. $ we know the perimeter of pentagon $abcde$ is 30 units. Find $cc_2. $
Answer:
64.03
Explanation:
Since the pentagon is translated 40 units north and 50 units east, we can look at c, c1 and c2 as a right triangle.
cc1 = 40
c1c2 = 50
By pythagoras theorem,
cc2² = cc1² + c1c2²
⇒ cc2 = √cc1² + c1c2²
cc2 =
\(\sqrt{40^{2} + 50^{2} } \\\\\sqrt{1600 + 2500} = \sqrt{4100} \\\\= 64.03\)
Given:A pentagon ABCDE is translated north by 40 units to pentagon A1B1C1D1E1. Pentagon A1B1C1D1E1 is then translated east by 50 units to pentagon A2B2C2D2E2. We know the perimeter of pentagon ABCDE is 30 units.
To find:\($CC_2$\)Solution:The diagram is shown below:In the above diagram, the given information is shown. Let the length of \($AE$ be $x$\).As we know that perimeter of pentagon $ABCDE$ is 30 units, so we can say that:AB + BC + CD + DE + EA = 30Since, Pentagon ABCDE is translated north by 40 units to pentagon \($A_1B_1C_1D_1E_1$.So, $A_1B_1$ = AB = $x$\)
We know that \($B_2C_2 = x$ and $B_2B = EA = x$. Therefore,$(C_2C)^2 = (x)^2 + (x)^2$$(C_2C)^2 = 2x^2$C2C = $\sqrt{2}x$Therefore, CC2 = C1C + C2C = 50 + C2C = 50 + $\sqrt{2}x$\)So, the value of \($CC_2$ is $50 + \sqrt{2}x$.\)
To know more about Pentagon visit:
https://brainly.com/question/27874618
#SPJ11