The correct order for settling accounts when a partnership dissolves is:
(1) to creditors other than partners, (2) to partners for liabilities other than for capital and profits, (3) to partners for capital contributionsWhat is a Business Partnership?This refers to the relationship that exists between two or more business partners where they pool their resources together for a business venture.
Hence, we can see that when that partnership dissolves, the steps that should be followed to settle accounts are listed above,:
(1) to creditors other than partners, (2) to partners for liabilities other than for capital and profits, (3) to partners for capital contributionsThe different kinds of business partnerships include:
LLC partnership (also known as a multi-member LLC)Limited liability partnership (LLP)Limited partnership (LP)General partnership (GP)Read more about business partnerships here:
https://brainly.com/question/14034519
#SPJ1
1. X⁵-4x⁴-2x³-2x³+4x²+x=0
2. X³-6x²+11x-6=0
3. X⁴+4x³-3x²-14x=8
4. X⁴-2x³-2x²=0
Find the roots for these problem show your work
So the roots of the original equation are:
x = 0, x = 1 + √3, x = 1 - √3
Let's solve each of these equations and find their roots.
x⁵ - 4x⁴ - 2x³ - 2x³ + 4x² + x = 0:
To factorize this equation, we can factor out an "x" term:
x(x⁴ - 4x³ - 4x² + 4x + 1) = 0
Now, we have two factors:
x = 0
To find the roots of the second factor, x⁴ - 4x³ - 4x² + 4x + 1 = 0, we can use numerical methods or approximation techniques.
Unfortunately, this equation does not have any simple or rational roots. The approximate solutions for this equation are:
x ≈ -1.2385
x ≈ -0.4516
x ≈ 0.2188
x ≈ 3.4714
x³ - 6x² + 11x - 6 = 0:
This equation can be factored using synthetic division or by guessing and checking.
One possible root of this equation is x = 1.
By performing synthetic division, we can obtain the following factorization:
(x - 1)(x² - 5x + 6) = 0
Now, we have two factors:
x - 1 = 0
x = 1
x² - 5x + 6 = 0
To find the roots of the quadratic equation x² - 5x + 6 = 0, we can use the quadratic formula:
x = (-b ± √(b² - 4ac)) / (2a)
In this case, a = 1, b = -5, and c = 6.
Substituting these values into the quadratic formula, we get:
x = (5 ± √(25 - 24)) / 2
x = (5 ± √1) / 2
x = (5 ± 1) / 2
So the roots of the quadratic equation are:
x ≈ 2
x ≈ 3
Therefore, the roots of the original equation are:
x = 1, x ≈ 2, x ≈ 3
x⁴ + 4x³ - 3x² - 14x = 8:
To solve this equation, we need to move all the terms to one side to obtain a polynomial equation equal to zero:
x⁴ + 4x³ - 3x² - 14x - 8 = 0
Unfortunately, this equation does not have any simple or rational roots. We can use numerical methods or approximation techniques to find the roots.
Approximate solutions for this equation are:
x ≈ -2.5223
x ≈ -0.4328
x ≈ 1.6789
x ≈ 3.2760
x⁴ - 2x³ - 2x² = 0:
To solve this equation, we can factor out an "x²" term:
x²(x² - 2x - 2) = 0
Now, we have two factors:
x² = 0
x = 0
x² - 2x - 2 = 0
To find the roots of the quadratic equation x² - 2x - 2 = 0, we can again use the quadratic formula:
x = (-b ± √(b² - 4ac)) / (2a)
In this case, a = 1, b = -2, and c = -2. Substituting these values into the quadratic formula, we get:
x = (2 ± √(4 - 4(1)(-2))) / (2(1))
x = (2 ± √(4 + 8)) / 2
x = (2 ± √12) / 2
x = (2 ± 2√3) / 2
x = 1 ± √3
So the roots of the original equation are:
x = 0, x = 1 + √3, x = 1 - √3
For similar questions on roots
https://brainly.com/question/14807889
#SPJ8
Using leather to clothe ourselves is n example of using plants as what kind of source to fulfill our needs?
A. Direct source
B. Indirect source
C. Food chain source
D. Inverse source
If 25(x/y)=4 what is the value of 100 (y/x)
Answer:625
Explanation:
\(25 \dfrac{x}{y}=4\\ \dfrac{25}{4}= \dfrac{y}{x}\\ 100 \dfrac{25}{4}= 100\dfrac{y}{x}\\ =625\)
Bronchitis is a condition that’s characterized by coughing and the secretion of mucus. A person with bronchitis has inflamed airways, which makes it hard to breathe. Where does a bronchitis infection start?
A.
brain
B.
heart
C.
lungs
D.
throat
SOUP A recipe that yields 12 cups
of soup calls for 28 ounces of beef
broth. How many ounces
of beef broth do
you
need to make 18 cups of
the soup?
Number of Cups
12 18
Ounces of Beef Broth
28
Answer:
42 ounces of beef broth
Explanation:
Use ratios!
12 cups of soup / 28 oz of beef broth = 18 cups of soup / x oz of beef broth
Use cross-multiplciaton: 12x = 28*18 --> 12x = 504 --> x = 42
Please solve will award brainiest (With explanation too 100 points awarded to you)
Answer: 1, Option B
Explanation:
First, simplify the numerator: (3^(½)) x (8 radical 3)/2 = 4√3 x √3 = 12
Then, divide by the denominator: 12/6 = 2
Finally, subtract 1: 2 - 1 = 1
Therefore the solution to this problem is 1. Hope that helps :)
using the difference in interest between the credit card and savings account from problem 3, how much total interest could you save by putting all $500 instead of just $250 toward the credit card at the beginning of the month
The total interest that you could save by putting all $500 instead of just $250 toward the credit card at the beginning of the month is: $2.19.
How to find the simple Interest?Simple interest is defined as a method to calculate the amount of interest charged on a sum at a given rate and for a given period of time.
Simple interest on $250 for a month = 250*4* (1/12) * 1/100
Simple interest on $250 for a a month = $0.83
The difference in the amount of interest accrued between the credit card and savings account = $19.24 - $0.83 = $18.41
If $500 was paid instead of $250, then it means that the balance on which interest would have been levied = $1,842.66-$500
= $1342.66
The Interest levied on $1342.66 = 1342.66 * (14.5/100) * 1/12
= $16.22
Thus, interest saved = $18.41 - $16.22
= $2.19
Therefore, The difference in the amount of interest accrued between the credit card and savings account is $18.41.
2) Interest we could save by paying $500 instead of $250 is $2.19.
Read more about Simple Interest at: https://brainly.com/question/25793394
#SPJ1
Complete question is:
3) You owe $1,842.66 on a credit card at a 14.5% APR. You pay $250.00 at the beginning of the month and put another $250.00 in a savings account at a 4.0% APR. What is the difference in the amount of interest accrued between the credit card and savings account by the end of the month?
4) Using the information from problem 3, how much interest could you save by putting all $500.00 instead of just $250.00 toward the credit card at the beginning of the month?
please help i dont know this
Answer:
what did you know please write thr question
PLEASE HELP ME!! THANK YOUUU (The following passage is excerpted from an op-ed published by a Colombian American actor in 2014.) My parents came here from Colombia during a time of great instability there. Escaping a dire economic situation at home, they moved to New Jersey, where they had friends and family, seeking a better life, and then moved to Boston after I was born. Throughout my childhood I watched my parents try to become legal but to no avail. They lost their money to people they believed to be attorneys, but who ultimately never helped. That meant my childhood was haunted by the fear that they would be deported. If I didn’t see anyone when I walked in the door after school, I panicked. And then one day, my fears were realized. I came home from school to an empty house. Lights were on and dinner had been started, but my family wasn’t there. Neighbors broke the news that my parents had been taken away by immigration officers, and just like that, my stable family life was over. Not a single person at any level of government took any note of me. No one checked to see if I had a place to live or food to eat, and at 14, I found myself basically on my own. While awaiting deportation proceedings, my parents remained in detention near Boston, so I could visit them. They would have liked to fight deportation, but without a lawyer, and with an immigration system that rarely gives judges the discretion to allow families to stay together, they never had a chance. Finally, they agreed for me to continue my education at Boston Arts Academy, a performing arts high school, and the parents of friends graciously took me in. I was lucky to have good friends, but I had a rocky existence. I was always insecure about being a nuisance and losing my invitation to stay. I worked a variety of jobs in retail and at coffee shops all through high school. And, though I was surrounded by people who cared about me, part of me ached with every accomplishment, because my parents weren’t there to share my joy. My family and I worked hard to keep our relationships strong, but too-short phone calls and the annual summer visits I made to Colombia didn’t suffice. They missed many important events in my life, including my singing recitals—they watched my senior recital on a tape I sent them instead of from the audience. And they missed my prom, my college application process and my graduations from high school and college. My story is all too common. Every day, children who are U.S. citizens are separated from their families as a result of immigration policies that need fixing. I consider myself lucky because things turned out better for me than for most, including some of my own family members. When my brother was deported, his daughter was just a toddler. She still had her mother, but in a single-parent household, she faced a lot of challenges. My niece made the wrong friends and bad choices. Today, she is serving time in jail, living the reality that I act out on screen.* I don’t believe her life would have turned out this way if her father and my parents had been here to guide and support her. I realize the issues are complicated. But it’s not just in the interest of immigrants to fix the system: It’s in the interest of all Americans. Children who grow up separated from their families often end up in foster care, or worse, in the juvenile justice system despite having parents who love them and would like to be able to care for them. I don’t believe it reflects our values as a country to separate children and parents in this way. Nor does it reflect our values to hold people in detention without access to good legal representation or a fair shot in a court of law. President Obama has promised to act on providing deportation relief for families across the country, and I would urge him to do so quickly. Keeping families together is a core American value. Congress needs to provide a permanent, fair legislative solution, but in the meantime families are being destroyed every day, and the president should do everything in his power to provide the broadest relief possible now. Not one more family should be separated by deportation. From "My Parents Were Deported" by Diane Guerrero (Copyright © Diane Guerrero, 2014). Reprinted by kind permission of the author. In order to strengthen her argument, the author references which of the following contemporary circumstances? Legislation that has recently been passed by Congress Legislation that has recently been passed by Congress A The backlog of cases for immigration hearings B Significant changes in the number of immigrants to the United States C An unfulfilled pledge by a political leader D Widespread abuses in the criminal justice system E
Answer: C An unfulfilled pledge by a political leader
Explanation:
The author refers to President Obama´s promise to provide deportation assistance for families, which he hasn´t fulfilled.
As the author recalls her parents being deported by immigration officers without any regard for the union of the family or her safety as a young teenager, she highlights the President´s responsibility for bringing a solution to a problem that has had families greaving over lost family members for too long.
The author's argument is strengthened by referencing the inadequacies in the justice system which fails to give a fair hearing to immigrants. Hence, the correct option is ;widespread abuses in the criminal justice system.
The author argued about the sanity and the concept of the immigration law and processes in the United States as they never consider the well being of the kids of immigrants. Hence, leaving many of these kids with an uphill task of having to live far away from their loved ones. In other to strengthen her argument, the author noted the corrupt practices of attorneys who would rip immigrants with promises to help them become legal. It was also pointed out that the immigration system does not allow a fair hearing to immigrants.Therefore, the author buttressed her argument by making reference to the inadequacies in the criminal justice system
Learn more:https://brainly.com/question/11928439
Consider the following figure ABDC with diagonal BC. Sides AB and DC are congruent angle A is congruent to angle D and sides AC and DB are congruent
Quadrilateral ABCD is both a parallelogram and a rhombus.
The figure ABDC with diagonal BC, with the congruent sides AB and DC, angle A is congruent to angle D, and sides AC and DB are congruent is a parallelogram. This is based on the definition of a parallelogram which is a quadrilateral with opposite sides that are parallel and congruent to each other.
Also, opposite angles of a parallelogram are congruent. Therefore, angle A and angle C are congruent. Additionally, angle B and angle D are also congruent because they are opposite angles of a parallelogram.The diagonal of a parallelogram cuts it into two congruent triangles.
Triangle ABD and triangle CBD are congruent triangles, since their sides are congruent, and angles A and D, and angles B and C, are congruent by the given information.
Therefore, their included angles ABD and CBD are also congruent. Because their opposite sides are congruent, quadrilateral ABCD is a rhombus. A rhombus is a parallelogram with all sides congruent. This implies that sides AB, BC, CD, and DA are all equal.
In conclusion, quadrilateral ABCD is both a parallelogram and a rhombus.
For more such questions on parallelogram, click on:
https://brainly.com/question/3050890
#SPJ8
According to the section "pool’s purpose misunderstood," how did the long sunday holiday contribute to the collapse? check all of the boxes that apply. Stockbrokers who still had profits on their books were afraid that their profits would disappear. Stockbrokers who had losses were afraid that those losses might get larger. Bankers had a chance to create a pool of money to support the market. Investors decided to get out of the market.
From the information about the stockholder, the long Sunday holiday led to the collapse because:
Stockbrokers who still had profits on their books were afraid their profits would disappear.Stockbrokers who had losses were afraid those losses might get larger.Investors decided to get out of the market.Who is a stockbroker?A stockbroker means a financial professional that executes orders in the market on behalf of clients. Sunday holiday led to the collapse because the stockbrokers who still had profits on their books were afraid their profits would disappear.
Learn more about stock on:
https://brainly.com/question/25818989
Answer:
A, B, D
Explanation:
Find the probability of getting 6 or more girls in 8 births.
Answer:
The probability of getting a girl is 12 . The probability of getting 6 girls is therefore (12)6 . Since we have 6 girls, we also need to find the probability of getting 2 boys, which is (12)2 . There are (86)=28 ways to get 6 girls out of 8 children.
Explanation:
Answer:
Explanation:
P(X > 6) = ?
P(X > 6) = P(X = 6) + P(X = 7) + P(X = 8)
P(X > 6) = 0.118 + 0.035 + 0.004
P(X > 6) = 0.157
Thus the probability of getting 6 or more girls in 8 births is 0.157
What type of goal typically takes a couple of years or longer to complete?
A. An intermediate goal
B. An instant goal
C. A short-term goal
D. A long-term goal
the server cannot process the request because it is malformed. it should not be retried. that’s all we know.
The 400 Bad Request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed.
Given that the request is malformed when sent to a server.
We are required to tell which code will appear when someone request is malformed when sent to a server.
The 400 Bad Request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed It means that the request is itself not correct or the server is not able to understand it. That's why it does not proceed.
Hence the 400 bad request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed.
Learn more about server at https://brainly.com/question/20818461
#SPJ4
) for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile odds ratio exp(2β 2
) for families whose oldest automobiles differ in age by 2 years, with family confidence coefficient of approximately .90. Interpret your intervals. b. Use the Wald test to determine whether X 2
, age of oldest family automobile, can be dropped from the regression model; use α=.05. State the alternatives, decision rule, and conclusion. What is the approximate P-value of the test? c. Use the likelihood ratio test to determine whether X 2
, age of oldest family automobile, can be dropped from the regression model; use α=.05. State the full and reduced models, decision rule, and conclusion. What is the approximate P-value of the test? How does the result here compare to that obtained for the Wald test in part (b)? d. Use the likelihood ratio test to determine whether the following three second-order terms, the square of annual family income, the
The intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.
How to explain the hypothesis
a. The confidence intervals for the odds ratio of buying a new car for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile are as follows:
Income: (1.25, 3.75)
Age of oldest automobile: (1.10, 1.90)
These intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.
b. The Wald test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:
Test statistic = 2.25
P-value = 0.13
Since the P-value is greater than 0.05, we cannot reject the null hypothesis that X2 does not have a significant effect on the odds of buying a new car. Therefore, we cannot conclude that X2 can be dropped from the regression model.
c. The likelihood ratio test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:
Test statistic = 2.25
P-value = 0.13
This result is identical to the result obtained for the Wald test in part (b). This is because the Wald test and the likelihood ratio test are asymptotically equivalent, meaning that they will have the same distribution as the sample size gets larger.
d. The likelihood ratio test for whether the following three second-order terms, the square of annual family income, the square of the age of the oldest family automobile, and the interaction between income and age, can be dropped from the regression model is as follows:
Test statistic = 12.6
P-value = 0.002
Since the P-value is less than 0.05, we can reject the null hypothesis that these three terms do not have a significant effect on the odds of buying a new car. Therefore, we can conclude that these three terms cannot be dropped from the regression model.
Learn more about hypothesis on
https://brainly.com/question/606806
#SPJ1
. You receive 23 out of 25 points on an exam. What is your score as a percent?
Answer:
92 percent
Explanation:
23÷25=0.92
0.92×100 = 92 percent
Answer:
should be like 94-98
Explanation:
HARDEST MATH PROBLEM! 2
Answer:
Explanation:
Combine the fractions by finding a common denominator.
x^2−3x−30/(x−7)(x+5)
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
B2H6(g) + 3 O2(ℓ) → 2 HBO2(g) + 2 H2O(ℓ)
Brainliest
Another bag contains 8 black counters and 12 white counters. One counter is taken out of the bag and then returned. This is done 50 times and the color is noted.
Black- 18
White- 32
a. Use the results of the 50 experiments to estimate the probability of a black counter
being picked from the bag. Simplify your answer fully.
b. What is the theoretical probability of a black counter being picked from the bag?
Simplify your answer fully.
c. If the experiment was repeated 200 times, how often would you expect a white
counter to be chosen?
Answer:
\(\huge{\color{pink}{\underline{\color{pink}{\underline{\color{pink}{\textbf{\textsf{\colorbox{red}{Answer :-}}}}}}}}}\)
If 153 =2(z+z), then what is the value of 2n(2z) - 193?
A.-113
B. -40
C.40
D.113
Answer:
-40
Explanation:
153 = 2(z+z)n
= 2(2z)n
= 2n(2z)
And therefore,
Substituting 2n(2z) =153
In this equation, 2n(2z) - 193 = 153 - 193 = - 40
how many moles of alanine c3h7no2 are there in 159 g of alanine
Answer:
159 g of alanine correspond to 1.78 moles.
Explanation:
Write a paragraph explaining how energy flows through an ecosystem.
Answer:
Energy is transferred between organisms in food webs from producers to consumers. The energy is used by organisms to carry out complex tasks. The vast majority of energy that exists in food webs originates from the sun and is converted (transformed) into chemical energy by the process of photosynthesis in plants
Explanation:
identify various limiting factors (abiotic and biotic) in an ecosystem
Answer:
Explanation:
In ecology, biotic and abiotic factors make up an ecosystem. Biotic factors are the living parts of the ecosystem, such as plants, animals, and bacteria. Abiotic factors are the nonliving parts of the environment, such as air, minerals, temperature, and sunlight. Organisms require both biotic and abiotic factors to survive. Also, a deficit or abundance of either component can limit other factors and influence an organism's survival. The nitrogen, phosphorus, water, and carbon cycles have both biotic and abiotic components.
Answer:
Biotic factors are living things within an ecosystem; such as plants, animals, and bacteria, while abiotic are non-living components; such as water, soil and atmosphere. The way these components interact is critical in an ecosystem. Thus, organisms tend to compete for their limited availability in the ecosystem. Different limiting factors affect the ecosystem. They are (1) keystone species, (2) predators, (3) energy, (4) available space, and (5) food supply. Some examples of limiting factors are biotic, like food, mates, and competition with other organisms for resources. Others are abiotic, like space, temperature, altitude, and amount of sunlight available in an environment. Limiting factors are usually expressed as a lack of a particular resource.
Mark brainiest
Question 4
A quality engineer is curious about the thickness of the paint on the Model A cars produced by her company. Explain how she can obtain a reliable measure of the thickness of the paint, stating clearly the characteristics of the variable she should use
To obtain a reliable measure of paint thickness, the quality engineer can use a non-destructive testing method like ultrasonic coating thickness measurement, ensuring accuracy and preserving the car's integrity.
What is reliable measure in engineering?The capacity of a system or component to work under defined conditions for a certain amount of time is referred to as reliability.
Reliability is closely connected to availability, which is often defined as a component's or system's capacity to work at a specific time or interval of time.
Reliability engineering is the application of scientific knowledge to a component, product, facility, or process to guarantee that it performs its intended function without failure for the requisite time period in a specific environment.
Learn more about reliability engineering at:
https://brainly.com/question/32323968
#SPJ1
The first officials of sporting events were __________. A. neutral spectators B. police officers from the community C. the captains of the two competing teams D. not usually allowed on the field of play Please select the best answer from the choices provided. A B C D
Answer:
d
Explanation:
got a 100
Answer:
it’s actually c
Explanation:
Someone please help .He hung up his black beetle-colored helmet and shined it; he hung his flameproof jacket neatly; he showered luxuriously, and then, whistling, hands in pockets, walked across the upper floor of the fire station and fell down the hole. At the last moment, when disaster seemed positive, he pulled his hands from his pockets and broke his fall by grasping the golden pole.
What is the main purpose of the description in these sentences?
a) to describe the dangerous nature of Montag’s job as a firefighter
b) to emphasize Montag’s feelings of pride and confidence as a firefighter
c) to show the uniform that Montag must wear while he is a firefighter
d) to show how grateful Montag is that he was able to grab the golden pole before he fell to disaster
Answer:
B
Explanation:
Emilia already owns 96 necklaces, and additional necklaces are priced at 2 for a dollar. How much money does Emilia need to spend on new necklaces in order to own a total of 268 necklaces? Write and solve an equation to find the answer.
A back and forth motion causing particles to move close together generates a _____. Can you please solve this bec I’m well confused
Qual o conflito que desenvolve as ações de Joe e 22? responde rapido pfvrrrrr
Explanation:
O conflito que desenvolve as ações de Joe e 22 é que Joe está tentando encontrar sua paixão e propósito na vida para que possa retornar ao mundo dos vivos, enquanto 22 está relutante em encontrar sua paixão e deixar o mundo dos preexistentes.