You are working in a real lab setting, and when you test the catalase and water together you see a reaction. This means that there are possible contaminant in the water causing a reaction.
For better understating, lets explain the statement above
The catalase test is simply known as a type of test that shows if catalase is in that reaction/test substance. A catalase is commonly known as enzyme that reduces into smaller pieces the harmful substance hydrogen peroxide into water and oxygen.If a catalase is produce by any test substance, be it an organism, it will give a bubbles of oxygen on the addition of hydrogen peroxideThe presence of contaminants can also cause a reaction that is not expected'
Conclusively, we can say Possible contaminant in the water can effect a kind of reaction
Learn more From:
https://brainly.com/question/17284132
3. List at least 5 ideas for a company name. (Complete sentences are not necessary. 2. 0 points) 4. Decide which name you will use for your company, and explain why you chose this name. (3. 0 points) 5. Will your company need a DBA name? Why or why not? (1-2 sentences. 3. 0 points) 6. Will you register your company name as a trademark with the state or USPTO, or both? Explain why or why not. (2-4 sentences. 3. 0 points) 7. List at least 3 places where you can look for information about licenses and permits. (3. 0 points) 8. If your business grows large, which type of business organization would you prefer to use (function, product, location, process, or customer)? Explain why. (2-3 sentences. 2. 0 points) 9. Will your business keep inventory? If so, list some of the types of inventory you will store. If not, explain why you won't need to have inventory. (2-3 sentences. 2. 0 points)
Five company name ideas: LightCraft, TechBuddies, EcoInnovate, ZenMind, FreshHarvest.
What is the reason for choosing this name?I choose EcoInnovate because it implies a focus on ecological sustainability and innovation, which are current market trends.
My company won't need a DBA name, as EcoInnovate clearly reflects the company's values and mission.
I will register EcoInnovate as a trademark with USPTO for nationwide protection. State registration isn’t as comprehensive.
For licenses and permits, check the Small Business Administration (SBA) website, your local Chamber of Commerce, and state government websites.
If my business grows large, I’d prefer a product-based organization to focus on specialized innovations.
My business will keep inventory including raw materials for product development and finished goods for customer orders.
Read more about trademark here:
https://brainly.com/question/11957410
#SPJ1
the production of cans sequentially in the factory: (guava-strawberry-mango-pineapple). what is the can number 321?
Answer: Guava
Explanation:
321/4 = 80.25
this means there will be 80 full "revolutions" of four cans, and 0.25, or 1/4th of a rotation.
it will end on Guava
Use the given data to construct a confidence interval for the population proportion p of the requested level.
X=47
N=71
Confidence level 98
The confidence interval for the population proportion p at a 98% confidence level is approximately (0.55297, 0.77097).
How to calculate the valueGiven data:
X = 47 (number of successes)
N = 71 (sample size)
Confidence level = 98%
First, we need to calculate the sample proportion:
p = X/N = 47/71 ≈ 0.66197
Now, we can calculate the margin of error (E):
E = Z * √((p1 - p))/n)
= 2.326 * √((0.66197(1 - 0.66197))/71)
≈ 0.109
Finally, we can construct the confidence interval:
CI = p ± E
= 0.66197 ± 0.109
Therefore, the confidence interval for the population proportion p at a 98% confidence level is approximately (0.55297, 0.77097).
Learn more about confidence interval on
https://brainly.com/question/20309162
#SPJ1
All of the following are components of the Aspire test except:
Answer:
A tool that provides info on how to apply for college.
Explanation:
Answer:
jExplanation:
Lesson 27 making statistical inferences answer key
A statistical inference is a process through which a researcher or analyst makes inferences about a population based on the statistics calculated from the sample.
What is the use of Statistical Inference?The purpose of statistical inferences are:
Learn more about Statistical Inferences at:
https://brainly.com/question/16816799
how does American culture support individualism?
could u help me pl/z
Answer:
sorry it is hard to answer the question when their is no question.
Explanation:
have a good day!
who is the first boxer in the world
Answer:
The first modern heavyweight-boxing champion was John L. Sullivan, whose career spanned the sports two eras. Sullivan was born in 1858 into an Irish immigrant family in Roxbury, Massachusetts.
Explanation:
Web developers need to know how long a page will take to load. The
table at left gives loading times according to page size when using a
particular interface. Which of the following statements best describes
the relationship between the page size and loading time?
Because the loading time grows by the same amount for every increase in page size, the relationship is linear.
What elements impact how quickly a page loads?The hosting server, amount of bandwidth used during transmission, web page design, as well as the quantity, nature, and weight of elements on the page, all affect how quickly a page loads. User location, device, and browser type are further considerations.
What affects page load time?It's just how quickly all of the content on a web page loads. Page type, user behaviour, file sizes, website server/host, inefficient code, hotlinking, and having too many plugins and/or widgets are just a few examples of the variables that can affect page speed.
To know more about page size visit:-
https://brainly.com/question/27897332
#SPJ1
If a solid were placed on the moon, would its density change?
O No, density is a measure of a mass to volume ratio. Mass does not change between planetary
objects.
O Yes, density is a measure of a mass to volume ratio. Mass does change between planetary objects.
O No, density is a measure of weight to volume ratio. Mass does not change between planetary
objects.
O Yes density is a measure of a weight to volume ratio, Weight does not change between planetary
objects.
Answer:
no
Explanation:
Moving from the gravity of the Earth to the gravity of the moon, the astronaut’s weight certainly changes, but his mass remains the same. There is less air pressure in space, but astronauts don’t blow up like bubbles once they leave Earth’s atmosphere, so you can safely assume that the astronaut’s volume doesn’t really change either. If the mass and the volume don’t change on the moon, you can deduce that the astronaut’s density would be the same.
If a solid were placed on the moon, its density does not change, density is a measure of a mass-to-volume ratio, hence option A is correct.
Why mass does not change between planetary objects?The astronaut's weight changes when he travels from Earth's gravity to the moon's gravity, but his mass does not. The volume of an astronaut doesn't really change even if there is less air pressure in space since astronauts don't blow up like bubbles once they leave Earth's atmosphere.
Density is defined as the measure of the compound from the ratio of mass and volume. It is related to the composition of the planet.
You can infer that the astronaut's density would remain constant if the mass and volume didn't change on the moon.
Therefore, density is a measure of a mass-to-volume ratio. Mass does not change between planetary objects.
Learn more about the planet, here:
https://brainly.com/question/30067719
#SPJ2
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
Fill in the blank with the correct imperfect conjugation of the verb in parentheses. Ella ____ a asistir a la clase pero no fue. (ir) va iba fue veía
The correct imperfect conjugation of the verb 'IR' is 'Ella IBA a asistir a la clase pero no fue'.
IR is a Spanish verb that means 'to go'. It is one of the most usually used verbs in Spanish.
This Spanish verb (ir) is irregular in the imperfect.
To form the imperfect tense of 'ir' verb takes off the -ir ending and adds the endings: -ía, -ías, -ía, -íamos, -íais, -ían.
For example:
Tú ibas (you were going)Ella iba (she went)Nosotros íbamos (we were going)Learn more in:
https://brainly.com/question/16396243
Answer:
B
Explanation:
A light source is shining on a vertical surface or a slanted surface as shown 3 points
below. Which statement is correct?
Surface is vertical
Surface is tilted
The light energy that hits the vertical surface is stronger because it is concentrated on
a smaller area.
The light energy that hits the vertical surface is weaker because it is concentrated on
a smaller area.
The light energy that hits the slanted surface is stronger because it is concentrated on
a larger area.
The light energy that hits the slanted surface is stronger because it is concentrated on
a smaller area
Answer:
The light energy that hits the vertical surface is stronger because it is concentrated on a smaller area.
Explanation:
Where were the empires of Ghana, Mali, and Songhai located? i will mark brainlyest if u anser and leave like on my profile
Answer:
the empires of Ghana,Mali and Songhai located on the western Africa since the 16 century
A rectangular prism with a length of 50 feet, width of 30 feet, and height of 20 feet. A rectangular pyramid with a base of 50 feet by 30 feet and height of 8 feet. Mr. Newman works as an architect. He created a solid foam model of a building that he is designing. How much foam was needed to make the model? 12,000 cm3 30,000 cm3 34,000 cm3 42,000 cm3
The foam that was needed to make the model is C 34,000 cm³
How to calculate the valueThe volume of a rectangular prism is length x width x height. The volume of the rectangular prism is 50 x 30 x 20 = 30,000 cubic feet.
The volume of a rectangular pyramid is (1/3) x base area x height. The base area of the rectangular pyramid is 50 x 30 = 1500 square feet. The volume of the rectangular pyramid is (1/3) x 1500 x 8 = 4000 cubic feet.
The total volume of the foam model is 30,000 + 4000
= 34,000 cubic feet.
So the answer is 34000
Learn more about prism on
https://brainly.com/question/23766958
#SPJ1
Which graph matches the equation y+3=2(x+3)?
ގއ
$
6
6
24
ވ މާ
Answer:
Answer:2dx
dy. And six (6)
A primary objective of the nep in the soviet union was to.
Answer:
The New Economic Policy reintroduced a measure of stability to the economy and allowed the Soviet people to recover from years of war, civil war, and governmental mismanagement.
Explanation:
Question :
what are dreams?
Answer:
although scientist aren't exactly sure why we dream, most believe that dreaming is the brains way of keeping it entertained while we sleep
Answer: What your mind thinks/processes of the thoughts your thinking and/or have thought of.
Explanation:
Walking logs can help you see where you have been and where you are going. A. True B. False
First off-let's check out Wikipedia.
a) Is this a reliable resource?
Why or why not?
b) How does the information get updated here?
a) Wikipedia can be a reliable resource, but it depends on the specific article and the sources cited. Wikipedia's articles are written and edited by volunteers from around the world, and while many contributors are knowledgeable and conscientious, others may be less so. The reliability of a Wikipedia article can also be affected by factors such as bias, incomplete information, or outdated sources. Therefore, it's generally a good practice to verify information from Wikipedia with additional sources.
b) Information on Wikipedia is updated by volunteers who edit articles using a collaborative process. Anyone can make edits to most articles, but changes to more high-profile or controversial pages may be subject to additional scrutiny by more experienced editors. Editors can add or remove information, correct errors, or update sources as necessary. Wikipedia also has a system of policies and guidelines that editors are expected to follow, which helps to ensure that articles are accurate, well-sourced, and written from a neutral point of view.
3a+45=52+2a find a.....
Explanation:
\(\tt{ 3a+45=52+2a }\) ⠀
\(\tt{3a-2a=52-45 }\) ⠀
\(\tt{ a=7 }\) ⠀
Explanation:
3a+45=52+2a2a-3a=45-52-a=-7a=7what do you mean by physical quality
Physical quality refers to a tangible object or entity's characteristics, attributes, or properties that determine its level of excellence, durability, reliability, or overall performance.
It refers to the objective measures of how well a product or service meets the established standards or specifications.
Physical quality is typically evaluated based on factors such as appearance, functionality, structural integrity, strength, precision, consistency, and other physical attributes.
For example, in manufacturing, physical quality may involve assessing the dimensional accuracy, material properties, surface finish, and overall workmanship of a product. In the context of services, physical quality may refer to the condition and maintenance of physical facilities, equipment, or infrastructure.
Maintaining high physical quality is important for customer satisfaction, as it directly affects the usability, reliability, and longevity of a product or service. By meeting or exceeding customer expectations in terms of physical quality, businesses can enhance their reputation, build customer loyalty, and gain a competitive advantage in the marketplace.
For more questions on Physical quality
https://brainly.com/question/19296380
#SPJ8
Before tryouts began, the boys seemed puzzled. Where, they wondered, was the coach? Luma was right in front of them, but a woman soccer coach was a strange sight to young Africans, and to young Muslim boys from Afghanistan and Iraq.
-Outcasts United, Warren St. John
Whose thoughts and feelings are revealed in the first two sentences?
What conclusion can be drawn based on the thoughts and feelings that are revealed?
Answer:
The thoughts and feelings revealed in the first two sentences belong to the boys preparing for the soccer tryouts. The conclusion that can be drawn is that the boys were surprised and confused to see a female soccer coach.
Imagine that you are the president of the supreme student government.
To write this argumentative paper include an introduction, body paragraphs with reasons and evidence, and a conclusion.
What is an argumentative paper?
In an argumentative paper, the author explains why his/her position about a specific subject is valid by providing evidence.
How to write an argumentative paper?Argumentative papers always include three main sections:
Introduction: Describe what the paper is about and the general context of it.Body paragraphs: Use at least one paragraph to explain each of the reasons why students should be allowed to wear civilian clothes on Fridays. Moreover, add evidence such as articles from the constitution about liberty of expression, scientific articles, etc. that show your position is valid.Conclusion: Summarize your ideas and re-state your position.Note: This question is incomplete. Here is the complete question.
Learning Task5: Imagine that you are the president of the supreme student government. As head of the governing body, you are tasked to submit an argument paper as to why students should be allowed to wear civilian clothes on Fridays.
Learn more about argumentative paper in: https://brainly.com/question/13702714
who is the richest person in word
Answer:
elon musk
Explanation:
Answer:
Jeff Bezos is the richest peroson in the world.
By artificial selection, certain traits have been selected to be passed on to the offspring in certain tomato plants. Which traits have been strongly influenced by genetics in these tomato plants?
Responses
Answer:
Fruit size and shape: Some tomato varieties have been bred to produce larger or smaller fruits with different shapes, such as round or oblong.Color: Tomato plants have been bred to produce fruits with different colors, such as red, yellow, orange, green, or even purple.Disease resistance: Tomato plants have been bred to resist certain diseases, such as verticillium or fusarium wilt, or pests such as the tomato hornworm.Flavor: Tomato plants have been bred to produce fruits with different flavors, such as sweet, tangy, or acidic.
a box in the shape of a right prism has a volume of 60cubic inches. if the dimensions of the box are 3 inches by 5 inches by h inches, what is the value of h?
Answer:
8
Explanation:
Right prism formula
1/2 (base) (length) (height)
60 = 1/2 (3) (5) (h)
120 = (3) (5) (h)
h = 120/15
h = 8
Check 1/2 ( 3) (5) (8) = 60
In a certain language “SUDAN” is coded as “45” and “ITALY” is coded as “9”. What will be the code for the “EGYPT” in that language?
who will tell in 4 minutes will be marked as brainliest
Answer:
If we consider each letter in the word "SUDAN" and "ITALY" as a digit, where "A" is represented by 1, "B" by 2, and so on, then we can add up the digits in each word to get their respective codes.
For "SUDAN," we have:
S = 19
U = 21
D = 4
A = 1
N = 14
Adding these up, we get:
19 + 21 + 4 + 1 + 14 = 59
So "SUDAN" is coded as "59."
For "ITALY," we have:
I = 9
T = 20
A = 1
L = 12
Y = 25
Adding these up, we get:
9 + 20 + 1 + 12 + 25 = 67
So "ITALY" is coded as "67."
Now, for "EGYPT," we have:
E = 5
G = 7
Y = 25
P = 16
T = 20
Adding these up, we get:
5 + 7 + 25 + 16 + 20 = 73
So "EGYPT" is coded as "73."
Students watched a cartoon either alone or with others and then rated they found the cartoon to be
The process by which nitrogen gas is converted to a usable form is called nitrogen.
Answer:
Fixation.Explanation:
The process by which nitrogen gas, atmospheric nitrogen (N2), is converted to a usuable form is called fixation.
This was originally answered by me already.
~Bunnypfpdude
Answer: fixation
Explanation: