your pc screen looks like this which part would you test indeed

Answers

Answer 1

If my pc screen looks like this (Image attached) the part that i would test indeed is the GPU.

What is a GPU in a computer?

The GPU is known to be the Graphics processing unit, and it is one that is said to be a specialized processor that was known to be made and designed to fasten graphics rendering.

Note that GPUs are tools that can help to process a lot of pieces of data simultaneously, and thus If my pc screen looks like this (Image attached) the part that i would test indeed is the GPU.

CPU testing is often done due to different reasons such as one wants to make sure every keys are working.

Therefore, if my pc screen looks like this (Image attached) the part that i would test indeed is the GPU.

Learn more about GPU from

https://brainly.com/question/474553

#SPJ1

Your Pc Screen Looks Like This Which Part Would You Test Indeed

Related Questions

PLEASE HELP STAT WILL GIVE BRAINLIEST

PLEASE HELP STAT WILL GIVE BRAINLIEST

Answers

Answer:

The answer is c hope it helps plz mark brainlist :)

ANSWER FAST!!!! Match the careers with the career clusters. (two answers in each group) CAREERS 1. electrician 2. wind turbine engineer 3. sewing machine operator 4. geologist 5. quality assurance inspector 6. farm labor contractor 7. animal trainer 8. carpenter GROUPS A. architecture and construction B. manufacturing C. agriculture, food and natural resources D. energy

Answers

Answer:

1.D 2.A 3.C 4.A 5.B 6.C

Explanation:

I hope this helps you some!

Answer:

A. architecture and construction -

8. carpenter

4. geologist

B. manufacturing -

5. quality assurance inspector

3. sewing machine operator

C. agriculture, food and natural resources -

6. farm labor contractor

7. animal trainer

D. energy -

1. electrician

2. wind turbine engineer

Explanation:

Consider the following figure ABDC with diagonal BC. Sides AB and DC are congruent angle A is congruent to angle D and sides AC and DB are congruent

Answers

Quadrilateral ABCD is both a parallelogram and a rhombus.

The figure ABDC with diagonal BC, with the congruent sides AB and DC, angle A is congruent to angle D, and sides AC and DB are congruent is a parallelogram. This is based on the definition of a parallelogram which is a quadrilateral with opposite sides that are parallel and congruent to each other.

Also, opposite angles of a parallelogram are congruent. Therefore, angle A and angle C are congruent. Additionally, angle B and angle D are also congruent because they are opposite angles of a parallelogram.The diagonal of a parallelogram cuts it into two congruent triangles.

Triangle ABD and triangle CBD are congruent triangles, since their sides are congruent, and angles A and D, and angles B and C, are congruent by the given information.

Therefore, their included angles ABD and CBD are also congruent. Because their opposite sides are congruent, quadrilateral ABCD is a rhombus. A rhombus is a parallelogram with all sides congruent. This implies that sides AB, BC, CD, and DA are all equal.

In conclusion, quadrilateral ABCD is both a parallelogram and a rhombus.

For more such questions on parallelogram, click on:

https://brainly.com/question/3050890

#SPJ8

Hello! What do you think a book about WW3 would be called?

Answers

Maybe “The Ultimate Civil War”

Which of the following is the best version of the underlined portion of sentence 14 (reproduced below)? The First and Second World Wars dampen enthusiasm for saengerfests in the United States, as anti-German sentiment rose in the midst of these conflicts.

Answers

Answer:

The First and Second World Wars dampened enthusiasm for saengerfests in the United States, as anti-German sentiment rose in the midst of these conflicts.

The enthusiasm for saengerfests in the United States waned during the First and Second World Wars.

What led to this?

This decline was primarily attributed to the growth of anti-German sentiment amidst these global conflicts.

As patriotic fervor intensified and tensions escalated, public interest in German cultural events like saengerfests dwindled. The negative perception of German heritage during the wars led to a decrease in participation and support for these traditional celebrations.

Read more about World Wars here:

https://brainly.com/question/446364

#SPJ2

Theoretical probability: there is a chance that a
student will be in Mrs. Jones' math
class. If there are 30 students in her class, how many students are there in all
class, how many students are there
in all?

Answers

Answer:

30!

Explanation:

you asked that if there are 30 students in her class,how many students are in her class.

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

Helpe no links please :( no wrong answers

Helpe no links please :( no wrong answers

Answers

Answer: Domain (Basically means the sets of values of x-axis).Hence, the set of values of domain is given by -3<domain<1. Meaning domain lies between values more than -3 and less than 1.

Range (Basically means the sets of values of y-axis). Hence, the set of values of range is given by -1<range<3. Meaning that range lies between values more than -1 and less than 3.

Function basically means the equation of the given circle. We know that equation of circle is given by;

(x-h)^2+ (y-k)^2 = r^2 [where (h, k) is the center of circle and r is the radius of circle]

From the figure,

(h, k)= (-1 ,1) and r= 2.

So, we can conclude that function is given by equation:

(x-(-1))^2 + (y-1)^2 =  2^2

(x+1)^2  +  (y-1)^2 = 4.


Robert, John, Enrique, Mark, and Thomas participate in a 2-mile run during gym class. The total average of all 5 runners is
15.3 minutes, and the average of Robert, John, and Enrique is 14.4 minutes. What is the average time for Mark and Thomas?

Answers

Answer:

Explanation:

Robert + John + Enrique + Mark + Thomas = 15.3 ------(1)

Robert + John + Enrique = 14.4 -------(2)

Putting value in Equation 1:

14.4 + Mark + Thomas  = 15.3

Hence:

Mark + Thomas = 0.9

A regular hexagon has a side length of 6k^2 + 8 inches long. What is the perimeter

Answers

A regular hexagon has six sides of equal length. If each side of the hexagon is 6k^2 + 8 inches long, then the perimeter of the hexagon is:

Perimeter = 6 × (6k^2 + 8)

Simplifying this expression gives:

Perimeter = 36k^2 + 48 inches

Therefore, the perimeter of the hexagon is 36k^2 + 48 inches.

Please help me with my work

Please help me with my work

Answers

Answer: do you still need help with it?

Explanation:

A country that creates a subsidy for domestic goods is most likely to experience which benefit

Answers

One of the experiences includes fixed market quantity.

Answer:

C.

Domestic companies will be better able to compete against foreign businesses.

Explanation:

a p e x

4. Why did Althea Gibson likely retire from tennis at the top of her game?​

Answers

Althea Gibson was a groundbreaking athlete and the first African-American woman to break the color barrier in professional tennis. Between 1956 and 1958 she won 56 titles, including 11 Grand Slam titles. Despite her meteoric rise to stardom, she retired from professional tennis at the age of 29 in 1958, at the peak of her career and with three more consecutive Grand Slam victories under her belt. Her decision to retire at the top of her game came as a shock to many, and a significant loss to the sport of tennis.

This paper seeks to explore the various factors that likely motivated Althea Gibson to retire from tennis at the top of her game. It is argued that Gibson's retirement was motivated by a combination of external and internal factors. Firstly, external factors such as racism and sexism likely played a role in her retirement. Gibson was the first African-American woman to dominate the sport, and was hampered by both racial and gender discrimination. Despite the successes she had achieved, Gibson was still not taken seriously in the eyes of many, which may have motivated her to retire from the sport prematurely.

In addition, Gibson's health may have also been an important factor motivating her retirement. After winning 11 Grand Slams by 1958, Gibson suffered multiple joint injuries, including chronic knee injuries. In addition to physical ailments, Gibson also faced mental and emotional exhaustion from the pressures of being a role model and the expectations that came with it. Furthermore, the racial and gender discrimination she had faced during her career likely added additional strain to an already challenging situation.

Finally, the lack of financial stability and security offered by tennis may have also been a motivating factor in Gibson's retirement. Despite her successes in the sport, Gibson did not have the means to maintain her career and support herself. This lack of support likely weighed heavily on her and may have contributed to her early retirement.

To conclude, Althea Gibson likely retired from tennis at the top of her game due to a combination of external and internal factors. Racism, sexism, her health, emotional exhaustion and the lack of financial stability offered by the sport likely all contributed to Gibson's decision to retire prematurely. While her retirement was a significant loss to the sport, her legacy as the first major African-American woman athlete still resonates today.

The first African-American tennis player, Althea Gibson, most likely left the sport while she was at the pinnacle of her game for a variety of reasons.

Here are a few explanations that could apply, albeit the precise causes can differ:

Pecuniary opportunities are scarce.Limited opportunities for tournaments.A need for a new challenge or burnout.The pursuit of other interests.

Thus, these elements shed light on the difficulties she had throughout her career and the causes that might have influenced her choice to leave tennis at the pinnacle of her accomplishment.

For more details regarding Althea Gibson, visit:

https://brainly.com/question/12418845

#SPJ1

1. The electric field at the point of charge!
2. The force experienced by the point charge as a result of the the electric field
3. The potential difference at the position of the point charge
4. The potential energy associated with the point charge
5. The acceleration of the point charge when it is released

Answers

Answer:so what is your question

Explanation:

g(x) = 2x - 1
h(x) = 1-g(x)
the functions g and h are defunded above. What is the value of h(0)

Answers

Answer:

2

Explanation:

Since h (x) = 1 − g (x), substituting 0 for x yields h (0) = 1 − g (0). Evaluating g (0) gives g (0) = 2(0) − 1 = −1. Therefore, h (0) = 1 − (−1) = 2.

If 25(x/y)=4 what is the value of 100 (y/x)

Answers

Answer:625

Explanation:

 \(25 \dfrac{x}{y}=4\\ \dfrac{25}{4}= \dfrac{y}{x}\\ 100 \dfrac{25}{4}= 100\dfrac{y}{x}\\ =625\)

) for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile odds ratio exp(2β 2
​ ) for families whose oldest automobiles differ in age by 2 years, with family confidence coefficient of approximately .90. Interpret your intervals. b. Use the Wald test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the alternatives, decision rule, and conclusion. What is the approximate P-value of the test? c. Use the likelihood ratio test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the full and reduced models, decision rule, and conclusion. What is the approximate P-value of the test? How does the result here compare to that obtained for the Wald test in part (b)? d. Use the likelihood ratio test to determine whether the following three second-order terms, the square of annual family income, the

Answers

The intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

How to explain the hypothesis

a. The confidence intervals for the odds ratio of buying a new car for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile are as follows:

Income: (1.25, 3.75)

Age of oldest automobile: (1.10, 1.90)

These intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

b. The Wald test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

Since the P-value is greater than 0.05, we cannot reject the null hypothesis that X2 does not have a significant effect on the odds of buying a new car. Therefore, we cannot conclude that X2 can be dropped from the regression model.

c. The likelihood ratio test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

This result is identical to the result obtained for the Wald test in part (b). This is because the Wald test and the likelihood ratio test are asymptotically equivalent, meaning that they will have the same distribution as the sample size gets larger.

d. The likelihood ratio test for whether the following three second-order terms, the square of annual family income, the square of the age of the oldest family automobile, and the interaction between income and age, can be dropped from the regression model is as follows:

Test statistic = 12.6

P-value = 0.002

Since the P-value is less than 0.05, we can reject the null hypothesis that these three terms do not have a significant effect on the odds of buying a new car. Therefore, we can conclude that these three terms cannot be dropped from the regression model.

Learn more about hypothesis on

https://brainly.com/question/606806

#SPJ1

Dean collected data on the favorite sports of the students of two grades. The table shows the relative frequencies of rows for the data collected: favorite sport swimming running volleyball row totals grade 8 0. 17 0. 24 0. 05 0. 46 grade 9 0. 14 0. 18 0. 22 0. 54 column totals 0. 31 0. 42 0. 27 1 based on the data, which statement is most likely correct? in grade 8, 17 students liked swimming. In grade 9, 27% of students liked volleyball. In grade 9, 14 students liked running. In grade 9, 18% of students liked running.

Answers

The statement that is most correct is (b) In Grade 8, 17% of students liked running.

How to interpret the two-way frequency table

The students that like swimming

From the table, we have the following highlights

24% students like swimming in grade 818% students like swimming in grade 9

The students that like running

From the table, we have the following highlights

17% students like running in grade 814% students like running in grade 9

The students that like volleyball

From the table, we have the following highlights

5% students like volleyball in grade 854% students like volleyball in grade 9

When the above highlights are compared to the given options, the correct statement is (b) In Grade 8, 17% of students liked running.

Read more about two-way frequency table at:

https://brainly.com/question/26313274

Dean collected data on the favorite sports of the students of two grades. The table shows the relative

Answer:

In Grade 9, 18% of students liked running.

Explanation:

Give two advantages of representing integers in binary rather than ASCII.

Answers

A binary number system is used in computer language, with zero representing a 'off' position and one representing a 'on' position. The benefits include easier coding, fewer computations, and fewer computational errors. Boolean algebra can also make use of the binary number system.

The two advantages of representing integers in binary rather than ASCII are

Binary numbers take up much less space example. 76 string requires two bytes, but the integer needs just 1 byte.Calculations are much simpler in Binary.

Computer language often make use of the binary number system with zero showing an off position and one showing an on position

The binary system is good as it

had ease of use in coding, fewer computations and less computational errors.

Conclusively, the Binary is regarded as a a base-2 number system that uses two mutually exclusive scenario to show information.

Learn more from

https://brainly.com/question/15981772



Plz I need the answer!!!:(

Select the correct items from the list.

You can classify some languages into multiple categories. Pick the categories in which the C++ programming language can be classified.

Procedural

Declarative

Imperative

Functional

Logic - Based

Object Oriented

Visual

4G

Choose all that apply

Answers

Answer:

I think is Procedural programming and

Functional programming

Explanation:

If the frequency of a wave is low, the ___ is also low. If the frequency of a wave is high, the ___ is also high.
Question 4 options:

tempo


dynamics


pitch

Answers

The answer is dynamics and pitch

why is Pluto called a ,"dwarf planet" ?​

Answers

Answer:

Pluto is called a dwarf planet because it does not meet the three criteria set forth by the International Astronomical Union (IAU) for a full-sized planet.

These criteria are:

It must be in orbit around the Sun.It must be massive enough for its self-gravity to overcome rigid body forces so that it assumes a hydro-static equilibrium (nearly round) shape.It has cleared the neighborhood around its orbit.

Pluto meets the first two criteria, but it does not meet the third. The Kuiper Belt is home to many other objects that are similar in size to Pluto, and these objects share Pluto's orbit. This means that Pluto has not cleared its neighborhood of other objects, as a planet is supposed to do.

As a result of this, Pluto was reclassified as a dwarf planet in 2006. There are now five dwarf planets in our solar system: Pluto, Ceres, Eris, Makemake, and Haumea.

Answer and Explanation:

Pluto is called a "dwarf planet" because it does not meet the criteria to be classified as a full-fledged planet. In 2006, the International Astronomical Union (IAU) redefined the definition of a planet, which led to Pluto being reclassified as a dwarf planet. Here are the main reasons why:

1. Size: While Pluto is larger than some moons in our solar system, it is much smaller than the eight traditional planets like Earth, Jupiter, and Saturn. Its size is comparable to other objects in the Kuiper Belt, a region beyond Neptune where many icy bodies reside.

2. Orbit: Unlike the eight planets that have relatively clear paths around the Sun, Pluto has a more elongated and inclined orbit. This means it has a more irregular path and crosses the orbit of Neptune at certain points. This is different from the regular, more circular orbits of the traditional planets.

3. Neighborhood: Pluto is part of a region called the Kuiper Belt, which consists of numerous icy bodies and small objects. This region is distinct from the inner solar system where the eight traditional planets reside. The presence of many similar-sized objects in its vicinity further influenced the decision to reclassify Pluto.

By considering these factors, the IAU determined that Pluto did not meet the criteria to be classified as a planet. Instead, it was designated as a dwarf planet, a new category that acknowledges its unique characteristics and its place in the Kuiper Belt.

It's important to note that this reclassification sparked some debate and controversy among astronomers and the public. However, the IAU's decision to classify Pluto as a dwarf planet is the current scientific consensus.

the server cannot process the request because it is malformed. it should not be retried. that’s all we know.

Answers

The 400 Bad Request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed.

Given that the request is malformed when sent to a server.

We are required to tell which code will appear when someone request is malformed when sent to a server.

The 400 Bad Request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed It means that the request is itself not correct or the server is not able to understand it. That's why it does not proceed.

Hence the 400 bad request error is an HTTP status code basically indicates that the request you sent to the webserver was malformed.

Learn more about server at https://brainly.com/question/20818461

#SPJ4

What type of goal typically takes a couple of years or longer to complete?
A. An intermediate goal
B. An instant goal
C. A short-term goal
D. A long-term goal​

Answers

This would be a long term goal. Please give brainliest I need four more

(9+33-6)divided 6-3 to the power of 2 pemdas

Answers

36 / 6 - 3^2
6 - 9
= -3

Since slope is calculated using the formula m = StartFraction v 2 minus v 1 Over x 2 minus x 1 EndFraction, the slope of both lines is equivalent to ________. It is given that the lines are parallel, and we calculated that the slopes are the same. Therefore, parallel lines have the same slopes. StartFraction v minus z Over w minus x EndFraction StartFraction w minus x Over v minus Z EndFraction StartFraction v minus z b Over x minus z a EndFraction StartFraction w minus x a Over v minus z b EndFraction

Answers

Answer:

Being equivelent gives them paralell lines on a graph.

Explanation:

They cross the same slope

The mainland of Southeast Asia is located on which type of landform? A. Tundra B. Plateau C. Desert D. Peninsula

Answers

Answer: B. Plateaus (and plains).

Answer:

A: Tundra

Explanation:

Ap ex

What did George Mason suggest must be included in the new Constitution? A bill of rights An aristocracy A monarchy.

Answers

Answer:

A Bill of Rights

Explanation:

George Mason insisted that the new constitution include a Bill of Rights. The Constitution, formally authorized in 1789, was a vast improvement when juxtaposed with the Articles of Confederation. The Bill of Rights offered important protections for citizens.

Answer:

There is no declaration of rights . . . Nor are the people secured even in the enjoyment of the benefit of the common law.

It is at present impossible to foresee whether [the Constitution] will, in its operation, produce a monarchy or a corrupt oppressive aristocracy.

Any body good with endive for boys?

Answers

Answer: Endive Nutrition Facts and Health Benefits

1. Aids in Cancer Prevention

2. Promotes Heart Health

3. Supports Good Vision

4. Aids Weight Loss

5. Supports a Healthy Pregnancy

6. Allergies

A coffee shop sells special blend of coffee
that comes in a 100-pound bag and costs
$3.50 per pound. It is a mix of coffee from
Costa Rica at $4 per pound and Columbian at
$3 per pound. Find the amounts of each type
of coffee used to make the mix.

Answers

The cost of the Costa Rica and Columbian coffee are $200 and $150 respectively

What are the amounts of each of the coffee?

Let us recall that we are told that a  coffee shop sells special blend of coffee that comes in a 100-pound bag and costs $3.50 per pound. It is a mix of coffee from Costa Rica at $4 per pound and Columbian at $3 per pound.

Let the number of pounds of the  Costa Rica coffee be x and the number of pounds of the Columbian coffee be y.

Given that;

x + y = 100 ------- (1)

4 x + 3 y = 350 ------- (2)

y = 100 - x ----(3)

Substitute (3) into (2)

4x + 3(100 - x) = 350

4x + 300 - 3x = 350

x + 300 = 350

x = 350 - 300

x = 50

From(1)

50 + y = 100

y = 50

Then;

Cost of the Costa Rica coffee = 4(50) = $200

Cost of the Columbian coffee = 3(50) = 150

Learn more about coffee:https://brainly.com/question/17091368

#SPJ1

Other Questions
during the colonial period, about _______ percent of southern female slaves were field workers. Mr. spencer has several grandchildren, some of whom have outgrown their winter coats. he will be buying new coats for those who outgrew their old ones. n = the number of new coats mr. spencer will purchase o = the number of grandchildren who have outgrown their coats which variable is the independent variable? n o the registered nurse (rn) is organizing a community health care program for administering tetanus vaccinations. which member of the health care team is most suitable for being delegated the task of administering vaccinations? Explain why security and promoting communism were two concerns that influenced Soviet leaders. Ovid's metamorphoses offers a primary source for the labors of hercules. What is the context of telling this story? A ______writer can only show elapsed time rather than telling the reader about it A company contributes money towards a profit-sharing fund for its employees. Every 2 years, employees are free to withdraw money from their account without penalty. This benefit indicates which type of reinforcement schedule?. Is A gargoyle is like a waterspout for a building? Given an arithmetic sequence described by the formula a= -2(n - 1) + 7 find a^28 THE BEST ANSWER WILL GET BRAINLIESTIn the 1800s, Martha's Vineyard was home to a native Deaf population that spoke its own language called the Martha's Vineyard Sign Language. Explain what impact Martha's Vineyard had on Deaf culture and the formation of ASL. Determina cual fue el futuro de cada uno de los siguientes personajes de la pelcula Walkout:68. Moctezuma Esparza69. Victoria Castroa. Trabajador Socialb. Miembro del Consejo Escolar de Los ngelesc. Activista Comunitariosd. Administradora Universitaria70. Paula Crisstomo71. Carlos Montes72. Bobby Verdugoe. Activista Comunitario y Productor Ejecutivo Mark has 10 pens. Kate has 5 times as many pens as Mark. Which equation below answers how many pens Kate has? Which of the following events did Hitler exploit to strengthen hispower?Select one:The Reichstag Fire in 1933The Beer Hall Putsch in 1923The Five-Year Plan from 1928-1933The Great Purge from 1934-1939 How can you relate the blocks in the periodic table and the numbers of its column into the electron configuration How much will net operating income increase (decrease) per month if the monthly advertising budget increases by $8,400, the monthly sales volume increases by 100 units, and the total monthly sales increase by $9,500 What metaphors does Tecumseh use in the first paragraph? Why does he use these images Help me please this is getting tricky! A journal provides the balances for each account. information about a transaction in several different places. a list of all accounts used in the business. a chronological record of transactions Match the characters in animal farm with their personality traits The top three oil producers in the United States in a certain year were the Gulf of Mexico, Texas, and Alaska. The three regions were responsible for 64% of the United States oil production. The Gulf of Mexico and Texas combined for 47% of oil production. Texas produced 3% more than Alaska. What percent of United States oil production came from these regions?